| Histone H4 [Q9GRP6] | |
|---|---|
| Systematic Name | LMJ_0086 [Leishmania major] |
| Gene Name | L7845.05 |
| Molecular Weight | 11439 Da |
| Protein Sequence Size | 100 |
| Function | |
| Charge | 17.5 |
| Isoelectric Point | 11.1372 pH |
| Description | Histone H4. |
| Subcellular Location | N.A.[Predict] |
| E. C. Number | N.A. |
| Sequence | >tr|Q9GRP6|Q9GRP6_LEIMA Histone H4 - Leishmania major. AKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKRISSEVYEEVRRVLKAYV EDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA |
| DNA Sequence | |
| Histone H4 Q9GRP6] | |
|---|---|
| Metabolite Information | |
| Molecular Function | |
| Biochemical Pathway | |
| Regulatory Pathway | |
| KEGG Pathways | |
| Orthologs | ||||
| Homologs | GI | Percent Identity | Evalue | Score |
| Homo sapiens | PREDICTED: similar to germinal histone H4 gene isoform 4 [Homo sapiens] | 59 | 8e-27 | 115 |
| DEG Information | ||||
| DEG Protein | DEG Organism | Percent Identity | Evalue | Bit Score |
| Rv2242 hypothetical protein | Mycobacterium tuberculosis H37Rv | 28% | 1.8 | 24.3 |
| Post Translational Modification | ||||
| PTM Type | PTM Sub Type | Score | Modification Site | Prosite ID |
| Acylation | N-myristoylation site | 27-32; | PS00008 | |
| Amidation | Amidation site | 3-6; | PS00009 | |
| Phosphorylation | cAMP- and cGMP-dependent protein kinase phosphorylation site | 5-8; 43-46; 76-79; | PS00004 | |
| Phosphorylation | Casein kinase II phosphorylation site | 81-84; | PS00006 | |
| Phosphorylation | Protein kinase C phosphorylation site | 13-15; | PS00005 | |
| Histone H4 [Q9GRP6] | ||
|---|---|---|
| Model Information | ||
| Template PDB ID | 1id3F | |
| Percent Identity | 59% | |
| Target Region | 17-100 | |
| Template Region | 18-85 | |
| Domain Information | ||
|---|---|---|
| Domains | Start | End |
| Active Site Information | ||
|---|---|---|
| Residue | Active Site Number | Functional Part |
| Co-Factor | |
|---|---|
| Metal | Description |
| Ligands | |||||
|---|---|---|---|---|---|
| CAS number | Name | Mol. Weight | Mol. Formula | Smile Notation | PDB Reference |
| 16397-91-4 | MANGANESE (II) ION | 54.938 | Mn | [Mn+2] | 1id3 |
| Mutational Information | ||
|---|---|---|
| Residue | Feature | Description |
|
|
|
| Modeled Protein | Template Structure |
|
|
+----------<<< P R O C H E C K S U M = M A R Y >>>----------+ | = | | /var/www/html/Services/SAVES_3/jobs/5926080/Q9GRP6.pdb 2.0 84 = residues | | = | | Ramachandran plot: 97.4% core 2.6% allow 0.0% gener 0.0% = disall | | = | | All Ramachandrans: 0 labelled residues (out of 82) = | +| Chi1-chi2 plots: 1 labelled residues (out of 48) = | | = | | Main-chain params: 6 better 0 inside 0 worse = | | Side-chain params: 5 better 0 inside 0 worse = | | = | *| Residue properties: Max.deviation: 2.5 Bad contacts: = 0 | *| Bond len/angle: 5.4 Morris et al class: 1 = 1 2 | | = | | G-factors Dihedrals: 0.25 Covalent: -0.10 Overall: = 0.12 | | = | | M/c bond lengths:100.0% within limits 0.0% highlighted = | | M/c bond angles: 96.9% within limits 3.1% highlighted = | | Planar groups: 100.0% within limits 0.0% highlighted = | | = | = +------------------------------------------------------------------------= ----+ + May be worth investigating further. * Worth investigating further. |