| Ubiquitin-conjugating enzyme e2, putative [Q4FZ06] | |
|---|---|
| Systematic Name | LMJ_0124 [Leishmania major] |
| Gene Name | |
| Molecular Weight | 17003 Da |
| Protein Sequence Size | 152 |
| Function | |
| Charge | -0.5 |
| Isoelectric Point | 6.3519 pH |
| Description | Ubiquitin-conjugating enzyme e2, putative. |
| Subcellular Location | N.A.[Predict] |
| E. C. Number | 6.3.2.- |
| Sequence | >tr|Q4FZ06|Q4FZ06_LEIMA Ubiquitin-conjugating enzyme e2, putative - Leishmania major. TVSPSSATSGAGATAARDSAAAALPAGLDLLHWEAGIPGKPGTPWEGGEFRLRLNFTEDY PTKPPKCVFTPVLFHPNVYPSGTVCLSILNEEKDWRPNITIKQILLAIQELLDHPNIKDP AQEEPYKVYMRDIKEYEARVREEVQRHHWKG |
| DNA Sequence | |
| Ubiquitin-conjugating enzyme e2, putative Q4FZ06] | |
|---|---|
| Metabolite Information | |
| Molecular Function | |
| Biochemical Pathway | |
| Regulatory Pathway | |
| KEGG Pathways | K10577 |
| Orthologs | ||||
| Homologs | GI | Percent Identity | Evalue | Score |
| Homo sapiens | ubiquitin-conjugating enzyme E2I [Homo sapiens] | 67 | 3e-44 | 174 |
| DEG Information | ||||
| DEG Protein | DEG Organism | Percent Identity | Evalue | Bit Score |
| YDL064w E2 ubiquitin-conjugating enzyme | Saccharomyces cerevisiae | 52% | 4e-35 | 140 |
| Post Translational Modification | ||||
| PTM Type | PTM Sub Type | Score | Modification Site | Prosite ID |
| PDOC00163 | Ubiquitin-conjugating enzymes signature and profile | 75-89; | PS00183 | |
| PDOC00163 | Ubiquitin-conjugating enzymes signature and profile | 33.391 | 30-139 | PS50127 |
| Acylation | N-myristoylation site | 11-16; 13-18; | PS00008 | |
| Glycosylation | N-glycosylation site | 56-59; 99-102; | PS00001 | |
| Phosphorylation | Casein kinase II phosphorylation site | 44-47; | PS00006 | |
| Phosphorylation | Protein kinase C phosphorylation site | 101-103; | PS00005 | |
| Ubiquitin-conjugating enzyme e2, putative [Q4FZ06] | ||
|---|---|---|
| Model Information | ||
| Template PDB ID | 2px9B | |
| Percent Identity | 67% | |
| Target Region | 1-152 | |
| Template Region | 1-158 | |
| Domain Information | ||
|---|---|---|
| Domains | Start | End |
| Active Site Information | ||
|---|---|---|
| Residue | Active Site Number | Functional Part |
| Co-Factor | |
|---|---|
| Metal | Description |
| Ligands | |||||
|---|---|---|---|---|---|
| CAS number | Name | Mol. Weight | Mol. Formula | Smile Notation | PDB Reference |
| Mutational Information | ||
|---|---|---|
| Residue | Feature | Description |
|
|
|
| Modeled Protein | Template Structure |
|
|
+----------<<< P R O C H E C K S U M = M A R Y >>>----------+ | = | | /var/www/html/Services/SAVES_3/jobs/229197/Q4FZ06.pdb 2.0 152 = residues | | = | +| Ramachandran plot: 93.7% core 5.6% allow 0.8% gener 0.0% = disall | | = | *| All Ramachandrans: 5 labelled residues (out of 150) = | +| Chi1-chi2 plots: 1 labelled residues (out of 87) = | | = | | Main-chain params: 6 better 0 inside 0 worse = | | Side-chain params: 5 better 0 inside 0 worse = | | = | +| Residue properties: Max.deviation: 4.2 Bad contacts: = 1 | +| Bond len/angle: 3.6 Morris et al class: 1 = 1 2 | +| 2 cis-peptides = | | G-factors Dihedrals: 0.10 Covalent: -0.12 Overall: = 0.01 | | = | | M/c bond lengths: 99.3% within limits 0.7% highlighted = | | M/c bond angles: 93.9% within limits 6.1% highlighted = | | Planar groups: 100.0% within limits 0.0% highlighted = | | = | = +------------------------------------------------------------------------= ----+ + May be worth investigating further. * Worth investigating further. |