| Serine peptidase, putative [Q4FYX5] | |
|---|---|
| Systematic Name | LMJ_0156 [Leishmania major] |
| Gene Name | |
| Molecular Weight | 90900 Da |
| Protein Sequence Size | 817 |
| Function | |
| Charge | 6 |
| Isoelectric Point | 6.962 pH |
| Description | Serine peptidase, putative. |
| Subcellular Location | N.A.[Predict] |
| E. C. Number | N.A. |
| Sequence | >tr|Q4FYX5|Q4FYX5_LEIMA Serine peptidase, putative - Leishmania major. LRRCLAQASTALRCGSTAALAAPFAPFGCGATRTAAVDAVACSRLASSTAAYPTLRTSCR WQSTGVTPWKSSGNSGGGGNGGQQQGRTWVNPNAVPPGEFLKKYARDLTEEARTGRLDPI VGREEVIRRTIQVVSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGEVPESIKDRQVYAL DMGTLVAGAKFRGEFEERLKGVLKDTIESHGKVILFIDELHTLVGAGSSGDGSMDAANLL KPSLARGELHCIGATTLDEYRQHIEKDAALARRFQSVLVTEPTVEETISILRGIKEKYEA HHGCLIKDEALVYAAVNSHRYLSERRLPDKAIDLIDEAASRLRLQQESKPEALDLIEREL IRLKIEAEAVKKDKDEVGKEKLENLYEQISQKQKEYDALEERWKKEKNLFQTIKQRTEEL DVLRHHLEQAMNSGDFAKAGEIQHSQIPNLLKQIEKDKHLASSKNFMVHDSVTSKDIAEV IARATGIPVAQLMTSEREKLIHMDAELKKTIMGQDAAIESITNVVRISRAGLHSHKRPLG SFLFLGPTGVGKTEVCKSLAKFLFDDESFICRIDMSEYMERHSVHRLIGAPPGYVGYEEG GELTESVRRRPYQIVLFDEFEKAHPSVSNILLQVLDEGHLTDSHGRRVDFKNTIIILTSN IGADVIARLPEGKPSISAMPAVMEQVRQRLAPEFINRLDDIIMFNRLSREDIRSIVEILF AQVQKMLTEHNITLEESTEVYDWLSVNGYSAVYGARPLKRLVQSELLNQLALMLLDGRVR EGEHVRLSVQDGHVVVVANHALSPEKGPTDERLLDQ |
| DNA Sequence | |
| Serine peptidase, putative Q4FYX5] | |
|---|---|
| Metabolite Information | |
| Molecular Function | |
| Biochemical Pathway | |
| Regulatory Pathway | |
| KEGG Pathways | K03695 |
| Orthologs | ||||
| Homologs | GI | Percent Identity | Evalue | Score |
| Homo sapiens | suppressor of potassium transport defect 3 [Homo sapiens] | 33 | 2e-39 | 161 |
| DEG Information | ||||
| DEG Protein | DEG Organism | Percent Identity | Evalue | Bit Score |
| clpB ATP-dependent protease, chaperone | Salmonella typhimurium | 53% | 0 | 726 |
| Post Translational Modification | ||||
| PTM Type | PTM Sub Type | Score | Modification Site | Prosite ID |
| PDOC00017 | ATP/GTP-binding site motif A (P-loop) | 147-154; 547-554; | PS00017 | |
| PDOC00679 | Chaperonins clpA/B signatures | 236-248; | PS00870 | |
| PDOC00595 | Formate--tetrahydrofolate ligase signatures | 732-735; | PS00722 | |
| Acylation | N-myristoylation site | 16-21; 29-34; 31-36; 74-79; 77-82; 78-83; 79-84; 83-88; 150-155; 184-189; 226-231; 233-238; 487-492; 514-519; 550-555; 590-595; 601-606; | PS00008 | |
| Amidation | Amidation site | 645-648; | PS00009 | |
| Glycosylation | N-glycosylation site | 732-735; | PS00001 | |
| Phosphorylation | Casein kinase II phosphorylation site | 172-175; 229-232; 256-259; 257-260; 284-287; 349-352; 474-477; 496-499; 709-712; 715-718; 734-737; 789-792; | PS00006 | |
| Phosphorylation | Protein kinase C phosphorylation site | 55-57; 59-61; 115-117; 136-138; 172-174; 319-321; 324-326; 391-393; 413-415; 463-465; 474-476; 496-498; 535-537; 607-609; | PS00005 | |
| Phosphorylation | Tyrosine kinase phosphorylation site | 380-387; | PS00007 | |
| Sulfation | Tyrosine sulfation site | 591-605; | PS00003 | |
| Serine peptidase, putative [Q4FYX5] | ||
|---|---|---|
| Model Information | ||
| Template PDB ID | 1qvrC | |
| Percent Identity | 52% | |
| Target Region | 1-803 | |
| Template Region | 51-803 | |
| Domain Information | ||
|---|---|---|
| Domains | Start | End |
| Active Site Information | ||
|---|---|---|
| Residue | Active Site Number | Functional Part |
| Co-Factor | |
|---|---|
| Metal | Description |
| Ligands | |||||
|---|---|---|---|---|---|
| CAS number | Name | Mol. Weight | Mol. Formula | Smile Notation | PDB Reference |
| PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER | 506.196 | C10 H17 N6 O12 P3 | O=P(O)(O)NP(=O)(O)OP(=O)(O)OCC3OC(n2cnc1c(ncnc12)N)C(O)C3O | 1qvr | |
| PLATINUM (II) ION | 195.078 | Pt | [Pt+2] | 1qvr | |
| Mutational Information | ||
|---|---|---|
| Residue | Feature | Description |
|
|
|
| Modeled Protein | Template Structure |
|
|
+----------<<< P R O C H E C K S U M = M A R Y >>>----------+ | = | | /var/www/html/Services/SAVES_3/jobs/411744/Q4FYX5.pdb 2.0 801 = residues | | = | *| Ramachandran plot: 91.2% core 7.1% allow 1.1% gener 0.6% = disall | | = | *| All Ramachandrans: 26 labelled residues (out of 799) = | +| Chi1-chi2 plots: 4 labelled residues (out of 489) = | | = | | Main-chain params: 6 better 0 inside 0 worse = | | Side-chain params: 5 better 0 inside 0 worse = | | = | *| Residue properties: Max.deviation: 6.7 Bad contacts: = 21 | *| Bond len/angle: 11.3 Morris et al class: 1 = 1 3 | | = | | G-factors Dihedrals: 0.04 Covalent: -0.20 Overall: = -0.05 | | = | *| M/c bond lengths: 98.9% within limits 1.1% highlighted 3 off = graph | *| M/c bond angles: 94.0% within limits 6.0% highlighted 3 off = graph | | Planar groups: 100.0% within limits 0.0% highlighted = | | = | = +------------------------------------------------------------------------= ----+ + May be worth investigating further. * Worth investigating further. |